Structure
The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al. in 1981. Its full sequence is:
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
The rat and human peptides are identical and differ from the ovine sequence only by 7 amino acids.
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Read more about this topic: Corticotropin-releasing Hormone
Famous quotes containing the word structure:
“When a house is tottering to its fall,
The strain lies heaviest on the weakest part,
One tiny crack throughout the structure spreads,
And its own weight soon brings it toppling down.”
—Ovid (Publius Ovidius Naso)
“It is difficult even to choose the adjective
For this blank cold, this sadness without cause.
The great structure has become a minor house.
No turban walks across the lessened floors.
The greenhouse never so badly needed paint.”
—Wallace Stevens (1879–1955)
“Each structure and institution here was so primitive that you could at once refer it to its source; but our buildings commonly suggest neither their origin nor their purpose.”
—Henry David Thoreau (1817–1862)